Cart 45 Product Products 15 517,00 € (empty)
No products
To be determined Shipping
15 517,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 45 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 15 517,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 15 517,00 €
Data sheet of SUPT16H polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about SUPT16H polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00011198-A01 |
| Product name: | SUPT16H polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant SUPT16H. |
| Gene id: | 11198 |
| Gene name: | SUPT16H |
| Gene alias: | CDC68|FACT|FACTP140|FLJ10857|FLJ14010|FLJ34357|SPT16/CDC68 |
| Gene description: | suppressor of Ty 16 homolog (S. cerevisiae) |
| Genbank accession: | NM_007192 |
| Immunogen: | SUPT16H (NP_009123, 608 a.a. ~ 715 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | PGEQTVPALNLQNAFRIIKEVQKRYKTREAEEKEKEGIVKQDSLVINLNRSNPKLKDLYIRPNIAQKRMQGSLEAHVNGFRFTSVRGDKVDILYNNIKHALFQPCDGE |
| Protein accession: | NP_009123 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.99 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |