Cart 62 Product Products 20 943,80 € (empty)
No products
To be determined Shipping
20 943,80 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 62 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 20 943,80 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 20 943,80 €
Data sheet of PTENP1 purified MaxPab mouse polyclonal antibody (B01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Tr |
More info about PTENP1 purified MaxPab mouse polyclonal antibody (B01P)
| Brand: | Abnova |
| Reference: | H00011191-B01P |
| Product name: | PTENP1 purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human PTENP1 protein. |
| Gene id: | 11191 |
| Gene name: | PTENP1 |
| Gene alias: | PTEN-rs|PTEN2|PTH2|psiPTEN |
| Gene description: | phosphatase and tensin homolog pseudogene 1 |
| Genbank accession: | BC038293.2 |
| Immunogen: | PTENP1 (AAH38293.1, 1 a.a. ~ 369 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MGFPAERLEGVYRNNIDDVVRFLDSKHKNHYKIHNLCAERHYDTAKSNYRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAAIHCKAGKGRTGIMIYAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYLVKNHVDYRPVALLFHKMMFETIPMFSGGTCNPQFVVCQLKVKMYSSNSGPTRWEDKFMYFEFPQPLPVCGGIKVEFFHKQNKMLKKDKMFHFWVNTFFIPGPEETSEKVENGSLCDQEIDSICSIERADNDKEYLVLTLTKNDLDKANKDKANRYFSPNFKVKLYFTKTVEEPSNPEASSSTSVTPDVSDNEPDHYRYSDTTDSDPENEPFDEDQHTQITKV |
| Protein accession: | AAH38293.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of PTENP1 expression in transfected 293T cell line (H00011191-T01) by PTENP1 MaxPab polyclonal antibody. Lane 1: PTENP1 transfected lysate(40.59 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |