| Brand: | Abnova |
| Reference: | H00011190-M02 |
| Product name: | CEP250 monoclonal antibody (M02), clone 4A1 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CEP250. |
| Clone: | 4A1 |
| Isotype: | IgG2a Kappa |
| Gene id: | 11190 |
| Gene name: | CEP250 |
| Gene alias: | C-NAP1|CEP2|CNAP1|MGC88542 |
| Gene description: | centrosomal protein 250kDa |
| Genbank accession: | BC001433 |
| Immunogen: | CEP250 (AAH01433, 141 a.a. ~ 240 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | LTVDWSRARDELMRKESQWQMEQEFFKGYLKGEHGRLLSLWREVVTFRRHFLEMKSATDRDLMELKAEHVRLSGSLLTCCLRLTVGAQSREPNGSGRMDG |
| Protein accession: | AAH01433 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |