| Brand: | Abnova |
| Reference: | H00011184-M02 |
| Product name: | MAP4K1 monoclonal antibody (M02), clone 1G6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant MAP4K1. |
| Clone: | 1G6 |
| Isotype: | IgG1 Kappa |
| Gene id: | 11184 |
| Gene name: | MAP4K1 |
| Gene alias: | HPK1 |
| Gene description: | mitogen-activated protein kinase kinase kinase kinase 1 |
| Genbank accession: | NM_007181 |
| Immunogen: | MAP4K1 (NP_009112, 278 a.a. ~ 377 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | GLNRGLILDLLDKLKNPGKGPSIGDIEDEEPELPPAIPRRIRSTHRSSSLGIPDADCCRRHMEFRKLRGMETRPPANTARLQPPRDLRSSSPRKQLSESS |
| Protein accession: | NP_009112 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | MAP4K1 monoclonal antibody (M02), clone 1G6. Western Blot analysis of MAP4K1 expression in Jurkat. |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |