| Brand: | Abnova |
| Reference: | H00011180-M01 |
| Product name: | WDR6 monoclonal antibody (M01), clone 2D4 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant WDR6. |
| Clone: | 2D4 |
| Isotype: | IgG2a lambda |
| Gene id: | 11180 |
| Gene name: | WDR6 |
| Gene alias: | FLJ10218|FLJ52552|FLJ56107|MGC126756|MGC142027 |
| Gene description: | WD repeat domain 6 |
| Genbank accession: | BC002826 |
| Immunogen: | WDR6 (AAH02826, 1 a.a. ~ 289 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MHLSSHRLDEYWDRQRNRHRMVKVDPETRYMSLAVCELDQPGLGPLVAAACSDGAVRLFLLQDSGRILQLLAETFHHKRCVLKVHSFTHEAPNQRRRLLLCSAATDGSLAFWDLTTMLDHDSTVLEPPVDPGLPYRLGTPSLTLQAHSCGINSLHTLPTREGHHLVASGSEDGSLHVFVLAVEMLQLEEAVGEAGLVPQLRVLEEYSVPCAHAAHVTGLKILSPSIMVSASIDQRLTFWRLGHGEPTFMNSTVFHVPDVADMDCWPVSPEFGHRCALGGQGLEVYNWYD |
| Protein accession: | AAH02826 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (57.53 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | http://www.abnova.com/application_image/ |
| Application image note: | Detection limit for recombinant GST tagged WDR6 is approximately 3ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Identification and characterization of an insulin receptor substrate 4-interacting protein in rat brain: Implications for longevity.Chiba T, Inoue D, Mizuno A, Komatsu T, Fujita S, Kubota H, Luisa Tagliaro M, Park S, Trindade LS, Hayashida T, Hayashi H, Yamaza H, Higami Y, Shimokawa I. Neurobiol Aging. 2009 Mar;30(3):474-82. Epub 2007 Aug 27. |