| Brand: | Abnova |
| Reference: | H00011177-M01 |
| Product name: | BAZ1A monoclonal antibody (M01), clone 1F6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant BAZ1A. |
| Clone: | 1F6 |
| Isotype: | IgG2a Kappa |
| Gene id: | 11177 |
| Gene name: | BAZ1A |
| Gene alias: | ACF1|DKFZp586E0518|FLJ14383|WALp1|WCRF180|hACF1 |
| Gene description: | bromodomain adjacent to zinc finger domain, 1A |
| Genbank accession: | NM_013448 |
| Immunogen: | BAZ1A (NP_038476, 1457 a.a. ~ 1556 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | LVSKIQVPDYYDIIKKPIALNIIREKVNKCEYKLASEFIDDIELMFSNCFEYNPRNTSEAKAGTRLQAFFHIQAQKLGLHVTPSNVDQVSTPPAAKKSRI |
| Protein accession: | NP_038476 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | The roles of human sucrose nonfermenting protein 2 homologue in the tumor-promoting functions of Rsf-1.Sheu JJ, Choi JH, Yildiz I, Tsai FJ, Shaul Y, Wang TL, Shih IeM. Cancer Res. 2008 Jun 1;68(11):4050-7. |