No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,WB-Ti,IF,ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00011168-M02 |
| Product name: | PSIP1 monoclonal antibody (M02), clone 1C4 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant PSIP1. |
| Clone: | 1C4 |
| Isotype: | IgG1 Kappa |
| Gene id: | 11168 |
| Gene name: | PSIP1 |
| Gene alias: | DFS70|LEDGF|MGC74712|PAIP|PSIP2|p52|p75 |
| Gene description: | PC4 and SFRS1 interacting protein 1 |
| Genbank accession: | BC033817 |
| Immunogen: | PSIP1 (AAH33817, 1 a.a. ~ 50 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MTRDFKPGDLIFAKMKGYPHWPARVDEVPDGAVKPPTNKLPIFFFGTHET |
| Protein accession: | AAH33817 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (31.13 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | PSIP1 monoclonal antibody (M02), clone 1C4. Western Blot analysis of PSIP1 expression in human kidney. |
| Applications: | WB-Ce,WB-Ti,IF,ELISA,WB-Re |
| Shipping condition: | Dry Ice |