Cart 172 Product Products 60 179,14 € (empty)
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x Mouse...400,00 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
No products
To be determined Shipping
60 179,14 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 172 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 60 179,14 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 60 179,14 €
Data sheet of PSIP1 monoclonal antibody (M01), clone 3H1
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ti,IHC-P,S-ELISA,ELISA,WB-Re |
More info about PSIP1 monoclonal antibody (M01), clone 3H1
| Brand: | Abnova |
| Reference: | H00011168-M01 |
| Product name: | PSIP1 monoclonal antibody (M01), clone 3H1 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant PSIP1. |
| Clone: | 3H1 |
| Isotype: | IgG1 kappa |
| Gene id: | 11168 |
| Gene name: | PSIP1 |
| Gene alias: | DFS70|LEDGF|MGC74712|PAIP|PSIP2|p52|p75 |
| Gene description: | PC4 and SFRS1 interacting protein 1 |
| Genbank accession: | BC033817 |
| Immunogen: | PSIP1 (AAH33817, 1 a.a. ~ 50 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MTRDFKPGDLIFAKMKGYPHWPARVDEVPDGAVKPPTNKLPIFFFGTHET |
| Protein accession: | AAH33817 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (31.13 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to PSIP1 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml] |
| Applications: | WB-Ti,IHC-P,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | LEDGF/p75 functions downstream from preintegration complex formation to effect gene-specific HIV-1 integration.Shun MC, Raghavendra NK, Vandegraaff N, Daigle JE, Hughes S, Kellam P, Cherepanov P, Engelman A. Genes Dev. 2007 Jul 15;21(14):1767-78. |