| Brand: | Abnova |
| Reference: | H00011164-P01 |
| Product name: | NUDT5 (Human) Recombinant Protein (P01) |
| Product description: | Human NUDT5 full-length ORF ( NP_054861.2, 1 a.a. - 219 a.a.) recombinant protein with GST-tag at N-terminal. |
| Gene id: | 11164 |
| Gene name: | NUDT5 |
| Gene alias: | YSA1|YSA1H|hYSAH1 |
| Gene description: | nudix (nucleoside diphosphate linked moiety X)-type motif 5 |
| Genbank accession: | NM_014142.2 |
| Immunogen sequence/protein sequence: | MESQEPTESSQNGKQYIISEELISEGKWVKLEKTTYMDPTGKTRTWESVKRTTRKEQTADGVAVIPVLQRTLHYECIVLVKQFRPPMGGYCIEFPAGLIDDGETPEAAALRELEEETGYKGDIAECSPAVCMDPGLSNCTIHIVTVTINGDDAENARPKPKPGDGEFVEVISLPKNDLLQRLDALVAEEHLTVDARVYSYALALKHANAKPFEVPFLKF |
| Protein accession: | NP_054861.2 |
| Preparation method: | in vitro wheat germ expression system |
| Storage buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Quality control testing picture: |  |
| Note: | Best use within three months from the date of receipt of this protein. |
| Tag: | GST |
| Product type: | Proteins |
| Host species: | Wheat Germ (in vitro) |
| Antigen species / target species: | Human |
| Applications: | AP,Array,ELISA,WB-Re |
| Shipping condition: | Dry Ice |