| Brand: | Abnova |
| Reference: | H00011164-M04 |
| Product name: | NUDT5 monoclonal antibody (M04), clone 2A3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant NUDT5. |
| Clone: | 2A3 |
| Isotype: | IgG1 Kappa |
| Gene id: | 11164 |
| Gene name: | NUDT5 |
| Gene alias: | YSA1|YSA1H|hYSAH1 |
| Gene description: | nudix (nucleoside diphosphate linked moiety X)-type motif 5 |
| Genbank accession: | NM_014142 |
| Immunogen: | NUDT5 (NP_054861, 120 a.a. ~ 219 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | KGDIAECSPAVCMDPGLSNCTIHIVTVTINGDDAENARPKPKPGDGEFVEVISLPKNDLLQRLDALVAEEHLTVDARVYSYALALKHANAKPFEVPFLKF |
| Protein accession: | NP_054861 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western blot analysis of NUDT5 over-expressed 293 cell line, cotransfected with NUDT5 Validated Chimera RNAi ( Cat # H00011164-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with NUDT5 monoclonal antibody (M04), clone 2A3 (Cat # H00011164-M04 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
| Shipping condition: | Dry Ice |