No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,ELISA,WB-Re,WB-Tr |
| Brand: | Abnova |
| Reference: | H00011157-M01 |
| Product name: | LSM6 monoclonal antibody (M01), clone 4B5-1B10 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant LSM6. |
| Clone: | 4B5-1B10 |
| Isotype: | IgG1 kappa |
| Gene id: | 11157 |
| Gene name: | LSM6 |
| Gene alias: | YDR378C |
| Gene description: | LSM6 homolog, U6 small nuclear RNA associated (S. cerevisiae) |
| Genbank accession: | BC016026 |
| Immunogen: | LSM6 (AAH16026, 1 a.a. ~ 80 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MSLRKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEEYVNGQLKNKYGDAFIRGNNVLYISTQKRRM |
| Protein accession: | AAH16026 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (34.54 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of LSM6 expression in transfected 293T cell line by LSM6 monoclonal antibody (M01), clone 4B5-1B10. Lane 1: LSM6 transfected lysate(9.1 KDa). Lane 2: Non-transfected lysate. |
| Applications: | IF,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |