No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00011151-M01 |
Product name: | CORO1A monoclonal antibody (M01), clone 4G10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CORO1A. |
Clone: | 4G10 |
Isotype: | IgG2a Kappa |
Gene id: | 11151 |
Gene name: | CORO1A |
Gene alias: | CLABP|CLIPINA|FLJ41407|HCORO1|MGC117380|TACO|p57 |
Gene description: | coronin, actin binding protein, 1A |
Genbank accession: | NM_007074 |
Immunogen: | CORO1A (NP_009005, 360 a.a. ~ 461 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | QEDLYPPTAGPDPALTAEEWLGGRDAGPLLISLKDGYVPPKSRELRVNRGLDTGRRRAAPEASGTPSSDAVSRLEEEMRKLQATVQELQKRLDRLEETVQAK |
Protein accession: | NP_009005 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.96 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunoperoxidase of monoclonal antibody to CORO1A on formalin-fixed paraffin-embedded human lung. [antibody concentration 3 ug/ml] |
Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | The actin-binding protein CORO1A is a novel PU.1 (SPI1)- and CEBPA-regulated gene with significantly lower expression in APL and CEBPA-mutated AML patients.Federzoni EA, Humbert M, Valk PJ, Behre G, Leibundgut EO, Torbett BE, Fey MF, Tschan MP. Br J Haematol. 2012 Dec 17. doi: 10.1111/bjh.12170. |