| Brand: | Abnova |
| Reference: | H00011149-M01 |
| Product name: | BVES monoclonal antibody (M01), clone 1C3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant BVES. |
| Clone: | 1C3 |
| Isotype: | IgG2a Kappa |
| Gene id: | 11149 |
| Gene name: | BVES |
| Gene alias: | HBVES|MGC42413|POP1|POPDC1 |
| Gene description: | blood vessel epicardial substance |
| Genbank accession: | NM_007073 |
| Immunogen: | BVES (NP_009004, 262 a.a. ~ 360 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | YSLNDPTLNDKKAKKLEHQLSLCTQISMLEMRNSIASSSDSDDGLHQFLRGTSSMSSLHVSSPHQRASAKMKPIEEGAEDDDDVFEPASPNTLKVHQLP |
| Protein accession: | NP_009004 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | BVES monoclonal antibody (M01), clone 1C3. Western Blot analysis of BVES expression in IMR-32 ( Cat # L008V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |