No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00011149-M01 |
Product name: | BVES monoclonal antibody (M01), clone 1C3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant BVES. |
Clone: | 1C3 |
Isotype: | IgG2a Kappa |
Gene id: | 11149 |
Gene name: | BVES |
Gene alias: | HBVES|MGC42413|POP1|POPDC1 |
Gene description: | blood vessel epicardial substance |
Genbank accession: | NM_007073 |
Immunogen: | BVES (NP_009004, 262 a.a. ~ 360 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | YSLNDPTLNDKKAKKLEHQLSLCTQISMLEMRNSIASSSDSDDGLHQFLRGTSSMSSLHVSSPHQRASAKMKPIEEGAEDDDDVFEPASPNTLKVHQLP |
Protein accession: | NP_009004 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | BVES monoclonal antibody (M01), clone 1C3. Western Blot analysis of BVES expression in IMR-32 ( Cat # L008V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |