Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human,Mouse |
Host species | Rabbit |
Applications | WB-Ce,IF,WB-Tr |
Brand: | Abnova |
Reference: | H00011145-D01P |
Product name: | HRASLS3 purified MaxPab rabbit polyclonal antibody (D01P) |
Product description: | Rabbit polyclonal antibody raised against a full-length human HRASLS3 protein. |
Gene id: | 11145 |
Gene name: | PLA2G16 |
Gene alias: | AdPLA|H-REV107-1|HRASLS3|HREV107|HREV107-3|MGC118754 |
Gene description: | phospholipase A2, group XVI |
Genbank accession: | BC001387 |
Immunogen: | HRASLS3 (AAH01387.1, 1 a.a. ~ 162 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MRAPIPEPKPGDLIEIFRPFYRHWAIYVGDGYVVHLAPPSEVAGAGAASVMSALTDKAIVKKELLYDVAGSDKYQVNNKHDDKYSPLPCSKIIQRAEELVGQEVLYKLTSENCEHFVNELRYGVARSDQVRDVIIAASVAGMGLAAMSLIGVMFSRNKRQKQ |
Protein accession: | AAH01387.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse |
Application image: | ![]() |
Application image note: | Western Blot analysis of PLA2G16 expression in transfected 293T cell line (H00011145-T02) by PLA2G16 MaxPab polyclonal antibody. Lane 1: HRASLS3 transfected lysate(17.90 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Ce,IF,WB-Tr |
Shipping condition: | Dry Ice |