No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00011142-M10 |
| Product name: | PKIG monoclonal antibody (M10), clone 2D9 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PKIG. |
| Clone: | 2D9 |
| Isotype: | IgG2a Kappa |
| Gene id: | 11142 |
| Gene name: | PKIG |
| Gene alias: | MGC126458|MGC126459 |
| Gene description: | protein kinase (cAMP-dependent, catalytic) inhibitor gamma |
| Genbank accession: | NM_181805 |
| Immunogen: | PKIG (NP_861521, 1 a.a. ~ 76 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MMEVESSYSDFISCDRTGRRNAVPDIQGDSEAVSVRKLAGDMGELALEGAEGQVEGSAPDKEAGNQPQSSDGTTSS |
| Protein accession: | NP_861521 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (34.1 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |