No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00011141-M04 |
Product name: | IL1RAPL1 monoclonal antibody (M04), clone 1C10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant IL1RAPL1. |
Clone: | 1C10 |
Isotype: | IgG2a Kappa |
Gene id: | 11141 |
Gene name: | IL1RAPL1 |
Gene alias: | IL1R8|IL1RAPL|MRX10|MRX21|MRX34|OPHN4|TIGIRR-2 |
Gene description: | interleukin 1 receptor accessory protein-like 1 |
Genbank accession: | NM_014271 |
Immunogen: | IL1RAPL1 (NP_055086.1, 151 a.a. ~ 250 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | FEKAELSKSKEISCRDIEDFLLPTREPEILWYKECRTKTWRPSIVFKRDTLLIREVREDDIGNYTCELKYGGFVVRRTTELTVTAPLTDKPPKLLYPMES |
Protein accession: | NP_055086.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Detection limit for recombinant GST tagged IL1RAPL1 is approximately 0.3ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Mutations in the calcium-related gene IL1RAPL1 are associated with autism.Piton A, Michaud JL, Peng H, Aradhya S, Gauthier J, Mottron L, Champagne N, Lafreniere RG, Hamdan FF; S2D team, Joober R, Fombonne E, Marineau C, Cossette P, Dube MP, Haghighi P, Drapeau P, Barker PA, Carbonetto S, Rouleau GA. Hum Mol Genet. 2008 Dec 15;17(24):3965-74. Epub 2008 Sep 18. |