Product successfully added to your shopping cart
Quantity
Total
There are 1 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 289,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 289,00 €
Data sheet of IL1RAPL1 monoclonal antibody (M04), clone 1C10
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re |
More info about IL1RAPL1 monoclonal antibody (M04), clone 1C10
| Brand: | Abnova |
| Reference: | H00011141-M04 |
| Product name: | IL1RAPL1 monoclonal antibody (M04), clone 1C10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant IL1RAPL1. |
| Clone: | 1C10 |
| Isotype: | IgG2a Kappa |
| Gene id: | 11141 |
| Gene name: | IL1RAPL1 |
| Gene alias: | IL1R8|IL1RAPL|MRX10|MRX21|MRX34|OPHN4|TIGIRR-2 |
| Gene description: | interleukin 1 receptor accessory protein-like 1 |
| Genbank accession: | NM_014271 |
| Immunogen: | IL1RAPL1 (NP_055086.1, 151 a.a. ~ 250 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | FEKAELSKSKEISCRDIEDFLLPTREPEILWYKECRTKTWRPSIVFKRDTLLIREVREDDIGNYTCELKYGGFVVRRTTELTVTAPLTDKPPKLLYPMES |
| Protein accession: | NP_055086.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged IL1RAPL1 is approximately 0.3ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Mutations in the calcium-related gene IL1RAPL1 are associated with autism.Piton A, Michaud JL, Peng H, Aradhya S, Gauthier J, Mottron L, Champagne N, Lafreniere RG, Hamdan FF; S2D team, Joober R, Fombonne E, Marineau C, Cossette P, Dube MP, Haghighi P, Drapeau P, Barker PA, Carbonetto S, Rouleau GA. Hum Mol Genet. 2008 Dec 15;17(24):3965-74. Epub 2008 Sep 18. |