| Brand: | Abnova |
| Reference: | H00011138-M02 |
| Product name: | TBC1D8 monoclonal antibody (M02), clone 1A12 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TBC1D8. |
| Clone: | 1A12 |
| Isotype: | IgG2a Kappa |
| Gene id: | 11138 |
| Gene name: | TBC1D8 |
| Gene alias: | AD3|HBLP1|VRP |
| Gene description: | TBC1 domain family, member 8 (with GRAM domain) |
| Genbank accession: | NM_007063 |
| Immunogen: | TBC1D8 (NP_008994, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MEQLADVTLRRLLDNEVFDLDPDLQEPSQITKRDLEARAQNEFFRAFFRLPRKEKLHAVVDCSLWTPFSRCHTAGRMFASDSYICFASREDGCCKIILPLREVVSIEKME |
| Protein accession: | NP_008994 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | TBC1D8 monoclonal antibody (M02), clone 1A12 Western Blot analysis of TBC1D8 expression in K-562 ( Cat # L009V1 ). |
| Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |