Brand: | Abnova |
Reference: | H00011135-A01 |
Product name: | CDC42EP1 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a full-length recombinant CDC42EP1. |
Gene id: | 11135 |
Gene name: | CDC42EP1 |
Gene alias: | BORG5|CEP1|MGC15316|MSE55 |
Gene description: | CDC42 effector protein (Rho GTPase binding) 1 |
Genbank accession: | BC009356 |
Immunogen: | CDC42EP1 (AAH09356, 1 a.a. ~ 384 a.a) full-length recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | MPGPQGGRGAATMSLGKLSPVGWVSSSQGKRRLTADMISHPLGDFRHTMHVGRGGDVFGDTSFLSNHGGSSGSTHRSPRSFLAKKLQLVRRVGAPPRRMASPPAPSPAPPAISPIIKNAISLPQLNQAAYDSLVVGKLSFDSSPTSSTDGHSSYGLDSGFCTISRLPRSEKPHDRDRDGSFPSEPGLRRSDSLLSFRLDLDLGPSLLSELLGVMSLPEAPAAETPAPAANPPAPTANPTGPAANPPATTANPPAPAATPTGPAANPPAPAASSTPHGHCPNGVTAGLGPVAEVKSSPVGGGPRGPAGPALGRHWGAGWDGGHHYPEMDARQERVEVLPQARASWESLDEEWRAPQAGSRTPVPSTVQANTFEFADAEEDDEVKV |
Protein accession: | AAH09356 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (68.35 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | CDC42EP1 polyclonal antibody (A01), Lot # 051102JC01 Western Blot analysis of CDC42EP1 expression in MES-SA/Dx5 ( Cat # L021V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |