CD160 purified MaxPab rabbit polyclonal antibody (D01P) View larger

CD160 purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CD160 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Tr

More info about CD160 purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00011126-D01P
Product name: CD160 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human CD160 protein.
Gene id: 11126
Gene name: CD160
Gene alias: BY55|FLJ46513|NK1|NK28
Gene description: CD160 molecule
Genbank accession: NM_007053
Immunogen: CD160 (AAH14465.1, 1 a.a. ~ 181 a.a) full-length human protein.
Immunogen sequence/protein sequence: MLLEPGRGCCALAILLAIVDIQSGGCINITSSASQEGTRLNLICTVWHKKEEAEGFVVFLCKDRSGDCSPETSLKQLRLKRDPGIDGVGEISSQLMFTISQVTPLHSGTYQCCARSQKSGIRLQGHFFSILFTETGNYTVTGLKQRQHLEFSHNEGTLSSGFLQEKVWVMLVTSLVALQAL
Protein accession: AAH14465.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00011126-D01P-13-15-1.jpg
Application image note: Western Blot analysis of CD160 expression in transfected 293T cell line (H00011126-T02) by CD160 MaxPab polyclonal antibody.

Lane 1: CD160 transfected lysate(19.80 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy CD160 purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart