| Brand: | Abnova |
| Reference: | H00011124-M01 |
| Product name: | FAF1 monoclonal antibody (M01), clone 1A10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant FAF1. |
| Clone: | 1A10 |
| Isotype: | IgG1 Kappa |
| Gene id: | 11124 |
| Gene name: | FAF1 |
| Gene alias: | CGI-03|FLJ37524|HFAF1s|UBXD12|UBXN3A|hFAF1 |
| Gene description: | Fas (TNFRSF6) associated factor 1 |
| Genbank accession: | NM_007051 |
| Immunogen: | FAF1 (NP_008982, 551 a.a. ~ 650 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | EAIRLSLEQALPPEPKEENAEPVSKLRIRTPSGEFLERRFLASNKLQIVFDFVASKGFPWDEYKLLSTFPRRDVTQLDPNKSLLEVKLFPQETLFLEAKE |
| Protein accession: | NP_008982 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | FAF1 monoclonal antibody (M01), clone 1A10 Western Blot analysis of FAF1 expression in HeLa ( Cat # L013V1 ). |
| Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |