Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of FAF1 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about FAF1 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00011124-A01 |
| Product name: | FAF1 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant FAF1. |
| Gene id: | 11124 |
| Gene name: | FAF1 |
| Gene alias: | CGI-03|FLJ37524|HFAF1s|UBXD12|UBXN3A|hFAF1 |
| Gene description: | Fas (TNFRSF6) associated factor 1 |
| Genbank accession: | NM_007051 |
| Immunogen: | FAF1 (NP_008982, 551 a.a. ~ 650 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | EAIRLSLEQALPPEPKEENAEPVSKLRIRTPSGEFLERRFLASNKLQIVFDFVASKGFPWDEYKLLSTFPRRDVTQLDPNKSLLEVKLFPQETLFLEAKE |
| Protein accession: | NP_008982 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | FAF1 polyclonal antibody (A01), Lot # 051024JC01 Western Blot analysis of FAF1 expression in Hela S3 NE ( Cat # L013V3 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | VAPB/ALS8 interacts with FFAT-like proteins including the p97 cofactor FAF1 and the ASNA1 ATPase.Baron Y, Pedrioli PG, Tyagi K, Johnson C, Wood NT, Fountaine D, Wightman M, Alexandru G BMC Biol. 2014 May 29;12(1):39. |