| Brand: | Abnova |
| Reference: | H00011120-M01 |
| Product name: | BTN2A1 monoclonal antibody (M01), clone 3A1 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant BTN2A1. |
| Clone: | 3A1 |
| Isotype: | IgG2a Kappa |
| Gene id: | 11120 |
| Gene name: | BTN2A1 |
| Gene alias: | BK14H9.1|BT2.1|BTF1|DJ3E1.1|FLJ36567 |
| Gene description: | butyrophilin, subfamily 2, member A1 |
| Genbank accession: | BC016661 |
| Immunogen: | BTN2A1 (AAH16661, 1 a.a. ~ 334 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MESAAALHFSRPASLLLLLLSLCALVSAQFIVVGPTDPILATVGENTTLRCHLSPEKNAEDMEVRWFRSQFSPAVFVYKGGRERTEEQMEEYRGRTTFVSKDISRGSVALVIHNITAQENGTYRCYFQEGRSYDEAILHLVVAGLGSKPLISMRGHEDGGIRLECISRGWYPKPLTVWRDPYGGVAPALKEVSMPDADGLFMVTTAVIIRDKSVRNMSCSINNTLLGQKKESVIFIPESFMPSVSPCAVALPIIVVILMIPIAVCIYWINKLQKEKKILSGEKEFERETREIALKELEKERVQKEEELQVKEKLQEELRWRRTFLHAELQFFSN |
| Protein accession: | AAH16661 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged BTN2A1 is approximately 1ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA |
| Shipping condition: | Dry Ice |