View larger

FGFR1OP purified MaxPab mouse polyclonal antibody (B01P)

Reference:

Condition: New product

Data sheet of FGFR1OP purified MaxPab mouse polyclonal antibody (B01P)

Brand	Abnova
Product type	Primary antibodies
Reactivity	Human
Host species	Mouse
Applications	IF,WB-Tr

More info about FGFR1OP purified MaxPab mouse polyclonal antibody (B01P)

Brand:	Abnova
Reference:	H00011116-B01P
Product name:	FGFR1OP purified MaxPab mouse polyclonal antibody (B01P)
Product description:	Mouse polyclonal antibody raised against a full-length human FGFR1OP protein.
Gene id:	11116
Gene name:	FGFR1OP
Gene alias:	FOP
Gene description:	FGFR1 oncogene partner
Genbank accession:	NM_007045
Immunogen:	FGFR1OP (NP_008976.1, 1 a.a. ~ 399 a.a) full-length human protein.
Immunogen sequence/protein sequence:	MAATAAAVVAEEDTELRDLLVQTLENSGVLNRIKAELRAAVFLALEEQEKVENKTPLVNESLKKFLNTKDGRLVASLVAEFLQFFNLDFTLAVFQPETSTLQGLEGRENLARDLGIIEAEGTVGGPLLLEVIRRCQQKEKGPTTGEGALDLSDVHSPPKSPEGKTSAQTTPSKIPRYKGQGKKKTSGQKAGDKKANDEANQSDTSVSLSEPKSKSSLHLLSHETKIGSFLSNRTLDGKDKAGLCPDEDDMEGDSFFDDPIPKPEKTYGLRKEPRKQAGSLASLSDAPPLKSGLSSLAGAPSLKDSESKRGNTVLKDLKLISDKIGSLGLGTGEDDDYVDDFNSTSHRSEKSEISIGEEIEEDLSVEIDDINTSDKLDDLTQDLTVSQLSDVADYLEDVA
Protein accession:	NP_008976.1
Storage buffer:	In 1x PBS, pH 7.4
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody reactive against mammalian transfected lysate.
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Application image:
Application image note:	Western Blot analysis of FGFR1OP expression in transfected 293T cell line (H00011116-T01) by FGFR1OP MaxPab polyclonal antibody. Lane 1: FGFR1OP transfected lysate(43.89 KDa). Lane 2: Non-transfected lysate.
Applications:	IF,WB-Tr
Shipping condition:	Dry Ice

Reviews

Be the first to write your review !

Buy FGFR1OP purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart