RPP14 polyclonal antibody (A01) View larger

RPP14 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RPP14 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about RPP14 polyclonal antibody (A01)

Brand: Abnova
Reference: H00011102-A01
Product name: RPP14 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant RPP14.
Gene id: 11102
Gene name: RPP14
Gene alias: FLJ31508|P14
Gene description: ribonuclease P/MRP 14kDa subunit
Genbank accession: NM_007042
Immunogen: RPP14 (NP_008973, 1 a.a. ~ 75 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: MPAPAATYERVVYKNPSEYHYMKVCLEFQDCGVGLNAAQFKQLLISAVKDLFGEVDAALPLDILTYEEKTLSAIL
Protein accession: NP_008973
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00011102-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (34.36 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy RPP14 polyclonal antibody (A01) now

Add to cart