| Brand: | Abnova |
| Reference: | H00011093-A01 |
| Product name: | ADAMTS13 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant ADAMTS13. |
| Gene id: | 11093 |
| Gene name: | ADAMTS13 |
| Gene alias: | C9orf8|DKFZp434C2322|FLJ42993|MGC118899|MGC118900|TTP|VWFCP|vWF-CP |
| Gene description: | ADAM metallopeptidase with thrombospondin type 1 motif, 13 |
| Genbank accession: | NM_139025 |
| Immunogen: | ADAMTS13 (NP_620594, 1328 a.a. ~ 1427 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | FINVAPHARIAIHALATNMGAGTEGANASYILIRDTHSLRTTAFHGQQVLYWESESSQAEMEFSEGFLKAQASLRGQYWTLQSWVPEMQDPQSWKGKEGT |
| Protein accession: | NP_620594 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | ADAMTS13 polyclonal antibody (A01), Lot # 051109JC01 Western Blot analysis of ADAMTS13 expression in HeLa ( Cat # L013V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |