| Brand: | Abnova |
| Reference: | H00011086-M09 |
| Product name: | ADAM29 monoclonal antibody (M09), clone 3A6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ADAM29. |
| Clone: | 3A6 |
| Isotype: | IgG1 Kappa |
| Gene id: | 11086 |
| Gene name: | ADAM29 |
| Gene alias: | svph1 |
| Gene description: | ADAM metallopeptidase domain 29 |
| Genbank accession: | NM_014269 |
| Immunogen: | ADAM29 (NP_055084, 339 a.a. ~ 398 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | GMNHDEDTCRCSQPRCIMHEGNPPITKFSNCSYGDFWEYTVERTKCLLETVHTKDIFNVK |
| Protein accession: | NP_055084 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (32.34 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged ADAM29 is 0.3 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | ADAM29 Expression in Human Breast Cancer and its Effects on Breast Cancer Cells In Vitro.Zhao M, Jia W, Jiang WG, Wang P, DU G, Cheng S, Song M. Anticancer Res. 2016 Mar;36(3):1251-8. |