| Brand: | Abnova |
| Reference: | H00011086-M01A |
| Product name: | ADAM29 monoclonal antibody (M01A), clone 1F6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ADAM29. |
| Clone: | 1F6 |
| Isotype: | IgM Kappa |
| Gene id: | 11086 |
| Gene name: | ADAM29 |
| Gene alias: | svph1 |
| Gene description: | ADAM metallopeptidase domain 29 |
| Genbank accession: | NM_014269 |
| Immunogen: | ADAM29 (NP_055084, 339 a.a. ~ 398 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | GMNHDEDTCRCSQPRCIMHEGNPPITKFSNCSYGDFWEYTVERTKCLLETVHTKDIFNVK |
| Protein accession: | NP_055084 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |