| Brand: | Abnova |
| Reference: | H00011083-M04 |
| Product name: | DIDO1 monoclonal antibody (M04), clone 3B1 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant DIDO1. |
| Clone: | 3B1 |
| Isotype: | IgG1 Kappa |
| Gene id: | 11083 |
| Gene name: | DIDO1 |
| Gene alias: | BYE1|C20orf158|DATF1|DIDO2|DIDO3|DIO-1|DIO1|DKFZp434P1115|FLJ11265|KIAA0333|MGC16140|dJ885L7.8 |
| Gene description: | death inducer-obliterator 1 |
| Genbank accession: | BC014489 |
| Immunogen: | DIDO1 (AAH14489, 321 a.a. ~ 420 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | ILQVQDETHSETADQQEAKWRPGDADGTDCTSIGTIEQKSSEDQGIKGRIEKAANPSGKKKLKIFQPVIEAPGASKCIGPGCCHVAQPDSVYCSNDCILK |
| Protein accession: | AAH14489 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.41 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | DIDO1 monoclonal antibody (M04), clone 3B1. Western Blot analysis of DIDO1 expression in HepG2(Cat # L019V1 ). |
| Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |