DATF1 polyclonal antibody (A01) View larger

DATF1 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DATF1 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about DATF1 polyclonal antibody (A01)

Brand: Abnova
Reference: H00011083-A01
Product name: DATF1 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant DATF1.
Gene id: 11083
Gene name: DIDO1
Gene alias: BYE1|C20orf158|DATF1|DIDO2|DIDO3|DIO-1|DIO1|DKFZp434P1115|FLJ11265|KIAA0333|MGC16140|dJ885L7.8
Gene description: death inducer-obliterator 1
Genbank accession: BC014489
Immunogen: DATF1 (AAH14489, 321 a.a. ~ 420 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: ILQVQDETHSETADQQEAKWRPGDADGTDCTSIGTIEQKSSEDQGIKGRIEKAANPSGKKKLKIFQPVIEAPGASKCIGPGCCHVAQPDSVYCSNDCILK
Protein accession: AAH14489
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00011083-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy DATF1 polyclonal antibody (A01) now

Add to cart