| Brand: | Abnova |
| Reference: | H00011082-M02 |
| Product name: | ESM1 monoclonal antibody (M02), clone 6D4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ESM1. |
| Clone: | 6D4 |
| Isotype: | IgG2b Kappa |
| Gene id: | 11082 |
| Gene name: | ESM1 |
| Gene alias: | endocan |
| Gene description: | endothelial cell-specific molecule 1 |
| Genbank accession: | NM_007036 |
| Immunogen: | ESM1 (NP_008967, 85 a.a. ~ 184 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | PSNGEDPFGEEFGICKDCPYGTFGMDCRETCNCQSGICDRGTGKCLKFPFFQYSVTKSSNRFVSLTEHDMASGDGNIVREEVVKENAAGSPVMRKWLNPR |
| Protein accession: | NP_008967 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to ESM1 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml] |
| Applications: | IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | ESM-1 silencing decreased cell survival, migration, and invasion and modulated cell cycle progression in hepatocellular carcinoma.Kang YH, Ji NY, Lee CI, Lee HG, Kim JW, Yeom YI, Kim DG, Yoon SK, Kim JW, Park PJ, Song EY. Amino Acids. 2010 Sep 7. [Epub ahead of print] |