| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Tr |
| Brand: | Abnova |
| Reference: | H00011082-B01P |
| Product name: | ESM1 purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human ESM1 protein. |
| Gene id: | 11082 |
| Gene name: | ESM1 |
| Gene alias: | endocan |
| Gene description: | endothelial cell-specific molecule 1 |
| Genbank accession: | NM_007036.3 |
| Immunogen: | ESM1 (NP_008967.1, 1 a.a. ~ 184 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MKSVLLLTTLLVPAHLVAAWSNNYAVDCPQHCDSSECKSSPRCKRTVLDDCGCCRVCAAGRGETCYRTVSGMDGMKCGPGLRCQPSNGEDPFGEEFGICKDCPYGTFGMDCRETCNCQSGICDRGTGKCLKFPFFQYSVTKSSNRFVSLTEHDMASGDGNIVREEVVKENAAGSPVMRKWLNPR |
| Protein accession: | NP_008967.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of ESM1 expression in transfected 293T cell line (H00011082-T01) by ESM1 MaxPab polyclonal antibody. Lane 1: ESM1 transfected lysate(20.24 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |