KERA (Human) Recombinant Protein (Q01) View larger

KERA (Human) Recombinant Protein (Q01)

New product

374,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of KERA (Human) Recombinant Protein (Q01)

BrandAbnova
Product typeProteins
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about KERA (Human) Recombinant Protein (Q01)

Brand: Abnova
Reference: H00011081-Q01
Product name: KERA (Human) Recombinant Protein (Q01)
Product description: Human KERA partial ORF ( NP_008966, 253 a.a. - 351 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 11081
Gene name: KERA
Gene alias: CNA2|SLRR2B
Gene description: keratocan
Genbank accession: NM_007035
Immunogen sequence/protein sequence: GLPSRGFDVSSILDLQLSHNQLTKVPRISAHLQHLHLDHNKIKSVNVSVICPSPSMLPAERDSFSYGPHLRYLRLDGNEIKPPIPMALMTCFRLLQAVI
Protein accession: NP_008966
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture: qc_test-H00011081-Q01-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Host species: Wheat Germ (in vitro)
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Effects of Ultraviolet-A and Riboflavin on the Interaction of Collagen and Proteoglycans during Corneal Cross-linking.Zhang Y, Conrad AH, Conrad GW.
J Biol Chem. 2011 Apr 15;286(15):13011-22. Epub 2011 Feb 18.

Reviews

Buy KERA (Human) Recombinant Protein (Q01) now

Add to cart