| Brand: | Abnova |
| Reference: | H00011076-B01P |
| Product name: | TPPP purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human TPPP protein. |
| Gene id: | 11076 |
| Gene name: | TPPP |
| Gene alias: | TPPP/p25|TPPP1|p24|p25|p25alpha |
| Gene description: | tubulin polymerization promoting protein |
| Genbank accession: | NM_007030 |
| Immunogen: | TPPP (NP_008961, 1 a.a. ~ 219 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MADKAKPAKAANRTPPKSPGDPSKDRAAKRLSLESEGAGEGAAASPELSALEEAFRRFAVHGDARATGREMHGKNWSKLCKDCQVIDGRNVTVTDVDIVFSKIKGKSCRTITFEQFQEALEELAKKRFKDKSSEEAVREVHRLIEGKAPIISGVTKAISSPTVSRLTDTTKFTGSHKERFDPSGKGKGKAGRVDLVDESGYVSGYKHAGTYDQKVQGGK |
| Protein accession: | NP_008961 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Rat |
| Application image: |  |
| Application image note: | TPPP MaxPab polyclonal antibody. Western Blot analysis of TPPP expression in rat brain. |
| Applications: | WB-Ti,WB-Tr |
| Shipping condition: | Dry Ice |