No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human,Rat |
Host species | Mouse |
Applications | WB-Ti,WB-Tr |
Brand: | Abnova |
Reference: | H00011076-B01P |
Product name: | TPPP purified MaxPab mouse polyclonal antibody (B01P) |
Product description: | Mouse polyclonal antibody raised against a full-length human TPPP protein. |
Gene id: | 11076 |
Gene name: | TPPP |
Gene alias: | TPPP/p25|TPPP1|p24|p25|p25alpha |
Gene description: | tubulin polymerization promoting protein |
Genbank accession: | NM_007030 |
Immunogen: | TPPP (NP_008961, 1 a.a. ~ 219 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MADKAKPAKAANRTPPKSPGDPSKDRAAKRLSLESEGAGEGAAASPELSALEEAFRRFAVHGDARATGREMHGKNWSKLCKDCQVIDGRNVTVTDVDIVFSKIKGKSCRTITFEQFQEALEELAKKRFKDKSSEEAVREVHRLIEGKAPIISGVTKAISSPTVSRLTDTTKFTGSHKERFDPSGKGKGKAGRVDLVDESGYVSGYKHAGTYDQKVQGGK |
Protein accession: | NP_008961 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Rat |
Application image: | ![]() |
Application image note: | TPPP MaxPab polyclonal antibody. Western Blot analysis of TPPP expression in rat brain. |
Applications: | WB-Ti,WB-Tr |
Shipping condition: | Dry Ice |