Cart 7 Product Products 2 185,25 € (empty)
No products
To be determined Shipping
2 185,25 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 7 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 2 185,25 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 2 185,25 €
Data sheet of TOPBP1 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about TOPBP1 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00011073-A01 |
| Product name: | TOPBP1 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant TOPBP1. |
| Gene id: | 11073 |
| Gene name: | TOPBP1 |
| Gene alias: | TOP2BP1 |
| Gene description: | topoisomerase (DNA) II binding protein 1 |
| Genbank accession: | NM_007027 |
| Immunogen: | TOPBP1 (NP_008958, 1327 a.a. ~ 1435 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | LLQSGGAKVLPGHSVPLFKEATHLFSDLNKLKPDDSGVNIAEAAAQNVYCLRTEYIADYLMQESPPHVENYCLPEAISFIQNNKELGTGLSQKRKAPTEKNKIKRPRVH |
| Protein accession: | NP_008958 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (38.1 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |