Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PL6 monoclonal antibody (M01), clone 3D4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re |
More info about PL6 monoclonal antibody (M01), clone 3D4
| Brand: | Abnova |
| Reference: | H00011070-M01 |
| Product name: | PL6 monoclonal antibody (M01), clone 3D4 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant PL6. |
| Clone: | 3D4 |
| Isotype: | IgG1 kappa |
| Gene id: | 11070 |
| Gene name: | TMEM115 |
| Gene alias: | PL6 |
| Gene description: | transmembrane protein 115 |
| Genbank accession: | BC017367 |
| Immunogen: | PL6 (AAH17367, 1 a.a. ~ 351 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MQRALPGARQHLGAILASASVVVKALCAAVLFLYLLSFAVDTGCLAVTPGYLFPPNFWIWTLATHGLMEQHVWDVAISLTTVVVAGRLLEPLWGALELLIFFSVVNVSVGLLGAFAYLLTYMASFNLVYLFTVRIHGALGFLGGVLVALKQTMGDCVVLRVPQVRVSVMPMLLLALLLLLRLATLLQSPALASYGFGLLSSWVYLRFYQRHSRGRGDMADHFAFATFFPEILQPVVGLLANLVHSLLVKVKICQKTVKRYDVGAPSSITISLPGTDPQDAERRRQLALKALNERLKRVEDQSIWPSMDDDEEESGAKVDSPLPSDKAPTPPGKGAAPESSLITFEAAPPTL |
| Protein accession: | AAH17367 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (64.35 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | PL6 monoclonal antibody (M01), clone 3D4 Western Blot analysis of PL6 expression in HepG2 ( Cat # L019V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | TMEM115 is an integral membrane protein of the Golgi complex involved in retrograde transport.Ong YS, Tran TH, Gounko NV, Hong W J Cell Sci. 2014 Jul 1;127(Pt 13):2825-39. doi: 10.1242/jcs.136754. Epub 2014 May 7. |