Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of UBE2C monoclonal antibody (M04), clone 3B1
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,ELISA,WB-Re,WB-Tr |
More info about UBE2C monoclonal antibody (M04), clone 3B1
| Brand: | Abnova |
| Reference: | H00011065-M04 |
| Product name: | UBE2C monoclonal antibody (M04), clone 3B1 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant UBE2C. |
| Clone: | 3B1 |
| Isotype: | IgG2a Kappa |
| Gene id: | 11065 |
| Gene name: | UBE2C |
| Gene alias: | UBCH10|dJ447F3.2 |
| Gene description: | ubiquitin-conjugating enzyme E2C |
| Genbank accession: | BC050736 |
| Immunogen: | UBE2C (AAH50736, 1 a.a. ~ 179 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MASQNRDPAATSVAAARKGAEPSGGAARGPVGKRLQQELMTLMMSGDKGISAFPESDNLFKWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKEKWSALYDVRTILLSIQSLLGEPNIDSPLNTHAAELWKNPTAFKKYLQETYSKQVTSQEP |
| Protein accession: | AAH50736 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (45.43 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of UBE2C expression in transfected 293T cell line by UBE2C monoclonal antibody (M04), clone 3B1. Lane 1: UBE2C transfected lysate(19.7 KDa). Lane 2: Non-transfected lysate. |
| Applications: | IF,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |