No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA |
| Brand: | Abnova |
| Reference: | H00011051-M01C |
| Product name: | NUDT21 monoclonal antibody (M01), clone 2G4-6F11 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant NUDT21. |
| Clone: | 2G4-6F11 |
| Isotype: | IgG1 Kappa |
| Gene id: | 11051 |
| Gene name: | NUDT21 |
| Gene alias: | CFIM25|CPSF5|DKFZp686H1588 |
| Gene description: | nudix (nucleoside diphosphate linked moiety X)-type motif 21 |
| Genbank accession: | BC001403 |
| Immunogen: | NUDT21 (AAH01403, 1 a.a. ~ 227 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MSVVPPNRSQTGWPRGVTQFGNKYIQQTKPLTLERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRRTVEGVLIVHEHRLPHVLLLQLGTTFFKLPGGELNPGEDEVEGLKRLMTEILGRQDGVLQDWVIDDCIGNWWRPNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDNAPGYGPIISSLPQLLSRFNFIYN |
| Protein accession: | AAH01403 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |