No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ti,S-ELISA,ELISA |
Brand: | Abnova |
Reference: | H00011051-M01 |
Product name: | NUDT21 monoclonal antibody (M01), clone 2G4-6F11 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant NUDT21. |
Clone: | 2G4-6F11 |
Isotype: | IgG1 Kappa |
Gene id: | 11051 |
Gene name: | NUDT21 |
Gene alias: | CFIM25|CPSF5|DKFZp686H1588 |
Gene description: | nudix (nucleoside diphosphate linked moiety X)-type motif 21 |
Genbank accession: | BC001403 |
Immunogen: | NUDT21 (AAH01403, 1 a.a. ~ 227 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MSVVPPNRSQTGWPRGVTQFGNKYIQQTKPLTLERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRRTVEGVLIVHEHRLPHVLLLQLGTTFFKLPGGELNPGEDEVEGLKRLMTEILGRQDGVLQDWVIDDCIGNWWRPNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDNAPGYGPIISSLPQLLSRFNFIYN |
Protein accession: | AAH01403 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Detection limit for recombinant GST tagged NUDT21 is approximately 1ng/ml as a capture antibody. |
Applications: | WB-Ti,S-ELISA,ELISA |
Shipping condition: | Dry Ice |