No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA |
Brand: | Abnova |
Reference: | H00011041-M03 |
Product name: | B4GAT1 monoclonal antibody (M03), clone 2H6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant B4GAT1. |
Clone: | 2H6 |
Isotype: | IgG2b Kappa |
Gene id: | 11041 |
Gene name: | B4GAT1 |
Gene alias: | B3GN-T1|B3GNT6|BETA3GNTI|iGAT|iGNT |
Gene description: | UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 1 |
Genbank accession: | NM_006876 |
Immunogen: | B4GAT1 (NP_006867.1, 316 a.a. ~ 415 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | AYVVPWQDPWEPFYVAGGKVPTFDERFRQYGFNRISQACELHVAGFDFEVLNEGFLVHKGFKEALKFHPQKEAENQHNKILYRQFKQELKAKYPNSPRRC |
Protein accession: | NP_006867.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Detection limit for recombinant GST tagged B4GAT1 is 3 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |