Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of RAB31 monoclonal antibody (M03), clone 4D12
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IF,ELISA,WB-Re |
More info about RAB31 monoclonal antibody (M03), clone 4D12
| Brand: | Abnova |
| Reference: | H00011031-M03 |
| Product name: | RAB31 monoclonal antibody (M03), clone 4D12 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant RAB31. |
| Clone: | 4D12 |
| Isotype: | IgG2a Kappa |
| Gene id: | 11031 |
| Gene name: | RAB31 |
| Gene alias: | Rab22B |
| Gene description: | RAB31, member RAS oncogene family |
| Genbank accession: | BC001148 |
| Immunogen: | RAB31 (AAH01148, 96 a.a. ~ 195 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | TLKKWVKELKEHGPENIVMAIAGNKCDLSDIREVPLKDAKEYAESIGAIVVETSAKNAINIEELFQGISRQIPPLDPHENGNNGTIKVEKPTMQASRRCC |
| Protein accession: | AAH01148 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | RAB31 monoclonal antibody (M03), clone 4D12. Western Blot analysis of RAB31 expression in Hela S3 NE(Cat # L013V3 ). |
| Applications: | WB-Ce,IF,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | p75 neurotrophin receptor regulates glucose homeostasis and insulin sensitivity.Baeza-Raja B, Li P, Le Moan N, Sachs BD, Schachtrup C, Davalos D, Vagena E, Bridges D, Kim C, Saltiel AR, Olefsky JM, Akassoglou K. Proc Natl Acad Sci U S A. 2012 Apr 10;109(15):5838-43. Epub 2012 Mar 28. |