Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of LILRA2 monoclonal antibody (M17), clone 3C7
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr |
More info about LILRA2 monoclonal antibody (M17), clone 3C7
| Brand: | Abnova |
| Reference: | H00011027-M17 |
| Product name: | LILRA2 monoclonal antibody (M17), clone 3C7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant LILRA2. |
| Clone: | 3C7 |
| Isotype: | IgG2b Kappa |
| Gene id: | 11027 |
| Gene name: | LILRA2 |
| Gene alias: | CD85H|ILT1|LIR-7|LIR7 |
| Gene description: | leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 2 |
| Genbank accession: | NM_006866 |
| Immunogen: | LILRA2 (NP_006857, 322 a.a. ~ 383 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | DRPSLSVQPVPTVAPGKNVTLLCQSRGQFHTFLLTKEGAGHPPLHLRSEHQAQQNQAEFRMG |
| Protein accession: | NP_006857 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (32.56 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of LILRA2 expression in transfected 293T cell line by LILRA2 monoclonal antibody (M17), clone 3C7. Lane 1: LILRA2 transfected lysate (Predicted MW: 51.2 KDa). Lane 2: Non-transfected lysate. |
| Applications: | ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |