No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,IP |
| Brand: | Abnova |
| Reference: | H00011009-M01 |
| Product name: | IL24 monoclonal antibody (M01), clone 4B6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant IL24. |
| Clone: | 4B6 |
| Isotype: | IgG2b Kappa |
| Gene id: | 11009 |
| Gene name: | IL24 |
| Gene alias: | C49A|FISP|IL-24|IL10B|MDA7|Mob-5|ST16|mda-7 |
| Gene description: | interleukin 24 |
| Genbank accession: | BC009681 |
| Immunogen: | IL24 (AAH09681, 58 a.a. ~ 167 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | GPCQVKGVVPQKLWEAFWAVKDTMQAQDNITSARLLQQEVLQNVSDAESCYLVHTLLEFYLKTVFKNYHNRTVEVRTLKSFSTLANNFVLIVSQLQPSQENEMFSIRDSA |
| Protein accession: | AAH09681 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Immunoprecipitation of IL24 transfected lysate using anti-IL24 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with IL24 MaxPab rabbit polyclonal antibody. |
| Applications: | ELISA,WB-Re,IP |
| Shipping condition: | Dry Ice |