| Brand: | Abnova |
| Reference: | H00011004-M01 |
| Product name: | KIF2C monoclonal antibody (M01), clone 1G2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant KIF2C. |
| Clone: | 1G2 |
| Isotype: | IgG1 kappa |
| Gene id: | 11004 |
| Gene name: | KIF2C |
| Gene alias: | KNSL6|MCAK |
| Gene description: | kinesin family member 2C |
| Genbank accession: | BC014924 |
| Immunogen: | KIF2C (AAH14924, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MAMDSSLQARLFPGLAIKIQRSNGLIHSANVRTVNLEKSCVSVEWAEGGATKGKEIDFDDVAAINPELLQLLPLHPKDNLPLQENVTIQKQKRRSVNSKI |
| Protein accession: | AAH14924 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to KIF2C on formalin-fixed paraffin-embedded human malignant lymphoma, diffuse large B. [antibody concentration 3 ug/ml] |
| Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Tr,IP,RNAi-Ab |
| Shipping condition: | Dry Ice |
| Publications: | Mitotic Rounding Alters Cell Geometry to Ensure Efficient Bipolar Spindle Formation.Lancaster OM, Le Berre M, Dimitracopoulos A, Bonazzi D, Zlotek-Zlotkiewicz E, Picone R, Duke T, Piel M, Baum B Dev Cell. 2013 May 13;25(3):270-83. doi: 10.1016/j.devcel.2013.03.014. Epub 2013 Apr 25. |