No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00010999-M01 |
| Product name: | SLC27A4 monoclonal antibody (M01), clone 1F4-1B10 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant SLC27A4. |
| Clone: | 1F4-1B10 |
| Isotype: | IgG1 kappa |
| Gene id: | 10999 |
| Gene name: | SLC27A4 |
| Gene alias: | ACSVL4|FATP4 |
| Gene description: | solute carrier family 27 (fatty acid transporter), member 4 |
| Genbank accession: | BC009959 |
| Immunogen: | SLC27A4 (AAH09959.1, 1 a.a. ~ 237 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MPLTLSTLLQPGRIWTGRRAAEPTPGHNAAWSLSGGGAAVLQAGAETALDPGGILPVVPLLGIWRLALHPGLHQDHQAYLTGDVLVMDELGYLYFRDRTGDTFRWKGENVSTTEVEGTLSRLLDMADVAVYGVEVPGTEGRAGMAAVASPTGNCDLERFAQVLEKELPLYARPIFLRLLPELHKTGTYKFQKTELRKEGFDPAIVKDPLFYLDAQKGRYVPLDQEAYSRIQAGEEKL |
| Protein accession: | AAH09959.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (51.81 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | SLC27A4 monoclonal antibody (M01), clone 1F4-1B10 Western Blot analysis of SLC27A4 expression in HeLa ( Cat # L013V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Mutations in the Fatty Acid Transport Protein 4 Gene Cause the Ichthyosis Prematurity Syndrome.Klar J, Schweiger M, Zimmerman R, Zechner R, Li H, Torma H, Vahlquist A, Bouadjar B, Dahl N, Fischer J. Am J Hum Genet. 2009 Aug;85(2):248-53. Epub 2009 Jul 23. |