| Brand: | Abnova |
| Reference: | H00010989-M01 |
| Product name: | IMMT monoclonal antibody (M01), clone 1A8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant IMMT. |
| Clone: | 1A8 |
| Isotype: | IgG2a Kappa |
| Gene id: | 10989 |
| Gene name: | IMMT |
| Gene alias: | DKFZp779P1653|HMP|MGC111146|P87|P87/89|P89|PIG4|PIG52 |
| Gene description: | inner membrane protein, mitochondrial (mitofilin) |
| Genbank accession: | NM_006839 |
| Immunogen: | IMMT (NP_006830, 481 a.a. ~ 580 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | TQLRRQAAAHTDHLRDVLRVQEQELKSEFEQNLSEKLSEQELQFRRLSQEQVDNFTLDINTAYARLRGIEQAVQSHAVAEEEARKAHQLWLSVEALKYSM |
| Protein accession: | NP_006830 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | SLC25A46 is required for mitochondrial lipid homeostasis and cristae maintenance and is responsible for Leigh syndrome.Janer A, Prudent J, Paupe V, Fahiminiya S, Majewski J, Sgarioto N, Des Rosiers C, Forest A, Lin ZY, Gingras AC, Mitchell G, McBride HM, Shoubridge EA. EMBO Mol Med. 2016 Jul 7. |