Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of RAB40B monoclonal antibody (M01A), clone 1A1
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA |
More info about RAB40B monoclonal antibody (M01A), clone 1A1
| Brand: | Abnova |
| Reference: | H00010966-M01A |
| Product name: | RAB40B monoclonal antibody (M01A), clone 1A1 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant RAB40B. |
| Clone: | 1A1 |
| Isotype: | IgG1 Kappa |
| Gene id: | 10966 |
| Gene name: | RAB40B |
| Gene alias: | FLJ42385|RAR|SEC4L |
| Gene description: | RAB40B, member RAS oncogene family |
| Genbank accession: | BC018039 |
| Immunogen: | RAB40B (AAH18039, 179 a.a. ~ 278 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | GMDRLWRPSKVLSLQDLCCRAVVSCTPVHLVDKLPLPIALRSHLKSFSMANGLNARMMHGGSYSLTTSSTHKRSSLRKVKLVRPPQSPPKNCTRNSCKIS |
| Protein accession: | AAH18039 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |