No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse,Rat |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00010963-M11 |
| Product name: | STIP1 monoclonal antibody (M11), clone 1E3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant STIP1. |
| Clone: | 1E3 |
| Isotype: | IgG2a Kappa |
| Gene id: | 10963 |
| Gene name: | STIP1 |
| Gene alias: | HOP|IEF-SSP-3521|P60|STI1|STI1L |
| Gene description: | stress-induced-phosphoprotein 1 |
| Genbank accession: | NM_006819 |
| Immunogen: | STIP1 (NP_006810.1, 445 a.a. ~ 543 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | TKAMDVYQKALDLDSSCKEAADGYQRCMMAQYNRHDSPEDVKRRAMADPEVQQIMSDPAMRLILEQMQKDPQALSEHLKNPVIAQKIQKLMDVGLIAIR |
| Protein accession: | NP_006810.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: | ![]() |
| Application image note: | Immunoperoxidase of monoclonal antibody to STIP1 on formalin-fixed paraffin-embedded human lung. [antibody concentration 3 ug/ml] |
| Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Glaucoma-associated WDR36 variants encode functional defects in a yeast model system.Footz TK, Johnson JL, Dubois S, Boivin N, Raymond V, Walter MA. Hum Mol Genet. 2009 Apr 1;18(7):1276-87. Epub 2009 Jan 15. |