Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of AF1Q monoclonal antibody (M01), clone 2A9-1B7
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re |
More info about AF1Q monoclonal antibody (M01), clone 2A9-1B7
| Brand: | Abnova |
| Reference: | H00010962-M01 |
| Product name: | AF1Q monoclonal antibody (M01), clone 2A9-1B7 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant AF1Q. |
| Clone: | 2A9-1B7 |
| Isotype: | IgG2a kappa |
| Gene id: | 10962 |
| Gene name: | MLLT11 |
| Gene alias: | AF1Q|RP11-316M1.10 |
| Gene description: | myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 11 |
| Genbank accession: | BC009624 |
| Immunogen: | AF1Q (AAH09624, 1 a.a. ~ 90 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MRDPVSSQYSSFLFWRMPIPELDLSELEGLGLSDTATYKVKDSSVGKMIGQATAADQEKNPEGDGLLEYSTFNFWRAPIASIHSFELDLL |
| Protein accession: | AAH09624 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.64 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged MLLT11 is approximately 0.03ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | AF1q: A Novel Mediator of Basal and 4-HPR-Induced Apoptosis in Ovarian Cancer Cells.Tiberio P, Cavadini E, Callari M, Daidone MG, Appierto V. PLoS One. 2012;7(6):e39968. Epub 2012 Jun 26. |