| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,S-ELISA,ELISA,WB-Re,WB-Tr |
| Brand: | Abnova |
| Reference: | H00010951-M01 |
| Product name: | CBX1 monoclonal antibody (M01), clone 4E12 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CBX1. |
| Clone: | 4E12 |
| Isotype: | IgG2a Kappa |
| Gene id: | 10951 |
| Gene name: | CBX1 |
| Gene alias: | CBX|HP1-BETA|HP1Hs-beta|HP1Hsbeta|M31|MOD1|p25beta |
| Gene description: | chromobox homolog 1 (HP1 beta homolog Drosophila ) |
| Genbank accession: | NM_006807 |
| Immunogen: | CBX1 (NP_006798.1, 2 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | GKKQNKKKVEEVLEEEEEEYVVEKVLDRRVVKGKVEYLLKWKGFSDEDNTWEPEENLDCPDLIAEFLQSQKTAHETDKSEGGKRKADSDSEDKGEESK |
| Protein accession: | NP_006798.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of CBX1 expression in transfected 293T cell line by CBX1 monoclonal antibody (M01), clone 4E12. Lane 1: CBX1 transfected lysate(21.4 KDa). Lane 2: Non-transfected lysate. |
| Applications: | IF,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |