Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PRSS21 monoclonal antibody (M01), clone 2E10
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,IP |
More info about PRSS21 monoclonal antibody (M01), clone 2E10
| Brand: | Abnova |
| Reference: | H00010942-M01 |
| Product name: | PRSS21 monoclonal antibody (M01), clone 2E10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PRSS21. |
| Clone: | 2E10 |
| Isotype: | IgG1 Kappa |
| Gene id: | 10942 |
| Gene name: | PRSS21 |
| Gene alias: | ESP-1|ESP1|TEST1|TESTISIN |
| Gene description: | protease, serine, 21 (testisin) |
| Genbank accession: | NM_006799 |
| Immunogen: | PRSS21 (NP_006790, 121 a.a. ~ 220 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | VSNIYLSPRYLGNSPYDIALVKLSAPVTYTKHIQPICLQASTFEFENRTDCWVTGWGYIKEDEALPSPHTLQEVQVAIINNSMCNHLFLKYSFRKDIFGD |
| Protein accession: | NP_006790 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoprecipitation of PRSS21 transfected lysate using anti-PRSS21 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with PRSS21 MaxPab rabbit polyclonal antibody. |
| Applications: | S-ELISA,ELISA,IP |
| Shipping condition: | Dry Ice |